dbPTM

YKW3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YKW3_SCHPO
UniProt AC	Q9C1X4
Protein Name	Uncharacterized RING finger protein P32A8.03c
Gene Name	SPAP32A8.03c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	513
Subcellular Localization
Protein Description
Protein Sequence	MESQPVIWYCHSCSNEFQRPGNCPRCNSDFVEMVEPNTAPEDDPRAANFVNATEFNDPNAMLQNILQSLGQGVVPNVNPTDANRTANPNTNSNPNPNATNAQPNPTMFSTGQFSTEQGLPNVFFGAAAAQPGSGTPFVMPGIVNAAQIRNFFQNIMGGNAPQPEANSEQARNANTETSNPPFASAQTQGQEHRPSSPNPAEHMTGAYVNTPLNQPPSYAASTQPEFQQTTSPIFSSSSTPPPPPPRPSQPTSGESQNTNPRFPFSAQSFVFSVGPNGALHQVNTSTENPQNAQAGAIPITDLGSILERIFGSLNQPGAQQGEGEPFNPANMFSNIFNLSGNPGDYAWGARGLDDIISQLMEQAQGHNAPAPAPEDVIAKMKVQKPPKELIDEEGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTCAICRAPVDPNSQQRNNTSTDSANGHNPSNHANPSTSTTNDQGATLRNESFNAASQSNLSSEHGHSSRTPMDDFVDEEPLE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
492	Phosphorylation	AASQSNLSSEHGHSS HHHHCCCCCCCCCCC	37.62	25720772
493	Phosphorylation	ASQSNLSSEHGHSSR HHHCCCCCCCCCCCC	36.46	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YKW3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YKW3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YKW3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABP1_SCHPO	cbp1	genetic	18818364
SRB11_SCHPO	srb11	genetic	18818364
AAKB_SCHPO	amk2	genetic	18818364
VRP1_SCHPO	vrp1	genetic	18818364
RAF2_SCHPO	raf2	genetic	22681890
TOM70_SCHPO	tom70	genetic	22681890
PVH1_SCHPO	SPBC17A3.06	genetic	22681890
PRS10_SCHPO	rpt4	genetic	22681890
RCD1_SCHPO	rcd1	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YKW3_SCHPO

Related Literatures of Post-Translational Modification