UniProt ID | SEC72_SCHPO | |
---|---|---|
UniProt AC | O14085 | |
Protein Name | Translocation protein sec72 | |
Gene Name | sec72 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 192 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Acts as non-essential component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and bip1 in a channel-forming translocon complex. A cycle of assembly and disassembly of Sec62/63 complex from sec61 may govern the activity of the translocon. sec72 may be involved in signal peptide recognition for a defined subset of leader peptides, or may increase the efficiency of unusual or "difficult" secretory precursors to the translocation pore, it may be that this protein binds charged leader peptides to the membrane until they engage the translocation apparatus (By similarity).. | |
Protein Sequence | MVAKQESVVAPQVDVSKWSGKELELGKKVNEYAKSLATFKYPFFIPPPYPPAKPNMALSTQVNKMKQTANEAFKRKKYEEAKKLYGLALQLALNRCTWEPSILTREEASVMLCNRAAAEIALSQFPEALADANAALKIRNNYGKCYYRKAKALEAMHRIEEAKQVVRDGLILAEPVTRNELVALWASYTEKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SEC72_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEC72_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEC72_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEC72_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YF54_SCHPO | SPAC3C7.04 | physical | 26771498 | |
YAWC_SCHPO | SPAC3F10.12c | physical | 26771498 | |
YGDG_SCHPO | SPBC1773.16c | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...