UniProt ID | HST2_SCHPO | |
---|---|---|
UniProt AC | Q9USN7 | |
Protein Name | NAD-dependent protein deacetylase hst2 | |
Gene Name | hst2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 332 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | NAD-dependent histone deacetylase, which could function in telomeric silencing, cell cycle progression and chromosome stability.. | |
Protein Sequence | MVKNTVKHVDSSKHLEKVASLIKEGKVKKICVMVGAGISTAAGIPDFRSPETGIYNNLQRFNLPYAEAVFDLSYFRKNPRPFYELAHELMPEKYRPTYTHYFIRLLHDKRLLQKCYTQNIDTLERLAGVPDKALIEAHGSFQYSRCIECYEMAETEYVRACIMQKQVPKCNSCKGLIKPMIVFYGEGLPMRFFEHMEKDTKVCDMALVIGTSLLVHPFADLPEIVPNKCQRVLINREPAGDFGERKKDIMILGDCDSQVRALCKLLGWSDELEKLIDTSVETLTEEISLLSVDSTIEKNASEQKKDDNSVNPFTKIEEKKKDEVTLLVSDDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HST2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HST2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HST2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SLM9_SCHPO | slm9 | genetic | 18931302 | |
DOHH_SCHPO | mmd1 | genetic | 18931302 | |
ERS1_SCHPO | ers1 | genetic | 18818364 | |
RAF1_SCHPO | raf1 | genetic | 18818364 | |
RAF2_SCHPO | raf2 | genetic | 18818364 | |
YCJ6_SCHPO | SPCC63.06 | genetic | 22681890 | |
RYH1_SCHPO | ryh1 | genetic | 22681890 | |
VTS1_SCHPO | SPBC13E7.03c | genetic | 22681890 | |
YCJD_SCHPO | SPCC63.13 | genetic | 22681890 | |
YJNG_SCHPO | SPCC24B10.16c | genetic | 22681890 | |
RPA12_SCHPO | rpa12 | genetic | 22681890 | |
TRMB_SCHPO | trm8 | genetic | 22681890 | |
NAA40_SCHPO | naa40 | genetic | 22681890 | |
YCP9_SCHPO | SPCC663.09c | genetic | 22681890 | |
SET1_SCHPO | set1 | genetic | 22681890 | |
SAT1_SCHPO | sat1 | genetic | 22681890 | |
SVP26_SCHPO | SPCC1795.10c | genetic | 22681890 | |
YCJE_SCHPO | eis1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...