dbPTM

YKU3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YKU3_SCHPO
UniProt AC	Q9P7C1
Protein Name	Uncharacterized J domain-containing protein C2E1P5.03
Gene Name	SPAC2E1P5.03
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	303
Subcellular Localization	Endoplasmic reticulum membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MSRIFILLLLFGVCLAWTSSDLEIFRVVDSLKSILKNKATFYELLEVPTKASIKEINRAYRKKSILYHPDKNPKSKELYTLLGLIVNILRNTETRKRYDYFLKNGFPRWKGTGYLYSRYRPGLGAVLVLLFLLISIAHFVMLVISSKRQKKIMQDHIDIARQHESYATSARGSKRIVQVPGGRRIYTVDSITGQVCILDPSSNIEYLVSPDSVASVKISDTFFYRLPRFIVWNAFGRWFARAPASSEDTDSDGQMEDEEKSDSVHKSSFSSPSKKEASIKAGKRRMKRRANRIPLSKNTNREN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
245	Phosphorylation	WFARAPASSEDTDSD HHCCCCCCCCCCCCC	32.95	25720772
246	Phosphorylation	FARAPASSEDTDSDG HCCCCCCCCCCCCCC	41.41	29996109
249	Phosphorylation	APASSEDTDSDGQME CCCCCCCCCCCCCCC	33.09	29996109
251	Phosphorylation	ASSEDTDSDGQMEDE CCCCCCCCCCCCCCH	45.81	25720772
261	Phosphorylation	QMEDEEKSDSVHKSS CCCCHHHHHCCCHHH	38.10	25720772
270	Phosphorylation	SVHKSSFSSPSKKEA CCCHHHCCCCCHHHH	43.20	21712547
271	Phosphorylation	VHKSSFSSPSKKEAS CCHHHCCCCCHHHHH	31.05	24763107
273	Phosphorylation	KSSFSSPSKKEASIK HHHCCCCCHHHHHHH	59.30	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YKU3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YKU3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YKU3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DDB1_SCHPO	ddb1	genetic	22681890
SVF1_SCHPO	SPCC584.11c	genetic	22681890
VTS1_SCHPO	SPBC13E7.03c	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YKU3_SCHPO

Related Literatures of Post-Translational Modification