UniProt ID | YKU3_SCHPO | |
---|---|---|
UniProt AC | Q9P7C1 | |
Protein Name | Uncharacterized J domain-containing protein C2E1P5.03 | |
Gene Name | SPAC2E1P5.03 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 303 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MSRIFILLLLFGVCLAWTSSDLEIFRVVDSLKSILKNKATFYELLEVPTKASIKEINRAYRKKSILYHPDKNPKSKELYTLLGLIVNILRNTETRKRYDYFLKNGFPRWKGTGYLYSRYRPGLGAVLVLLFLLISIAHFVMLVISSKRQKKIMQDHIDIARQHESYATSARGSKRIVQVPGGRRIYTVDSITGQVCILDPSSNIEYLVSPDSVASVKISDTFFYRLPRFIVWNAFGRWFARAPASSEDTDSDGQMEDEEKSDSVHKSSFSSPSKKEASIKAGKRRMKRRANRIPLSKNTNREN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
245 | Phosphorylation | WFARAPASSEDTDSD HHCCCCCCCCCCCCC | 32.95 | 25720772 | |
246 | Phosphorylation | FARAPASSEDTDSDG HCCCCCCCCCCCCCC | 41.41 | 29996109 | |
249 | Phosphorylation | APASSEDTDSDGQME CCCCCCCCCCCCCCC | 33.09 | 29996109 | |
251 | Phosphorylation | ASSEDTDSDGQMEDE CCCCCCCCCCCCCCH | 45.81 | 25720772 | |
261 | Phosphorylation | QMEDEEKSDSVHKSS CCCCHHHHHCCCHHH | 38.10 | 25720772 | |
270 | Phosphorylation | SVHKSSFSSPSKKEA CCCHHHCCCCCHHHH | 43.20 | 21712547 | |
271 | Phosphorylation | VHKSSFSSPSKKEAS CCHHHCCCCCHHHHH | 31.05 | 24763107 | |
273 | Phosphorylation | KSSFSSPSKKEASIK HHHCCCCCHHHHHHH | 59.30 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKU3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKU3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKU3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DDB1_SCHPO | ddb1 | genetic | 22681890 | |
SVF1_SCHPO | SPCC584.11c | genetic | 22681890 | |
VTS1_SCHPO | SPBC13E7.03c | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...