SFK1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SFK1_SCHPO
• UniProt AC: Q9Y7U1
• Protein Name: Protein sfk1
• Gene Name: sfk1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 328
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: May control the production of phosphatidylinositol 4-phosphate (PI4P)..
• Protein Sequence: MDNDYTTSTTTSRRPRFWGFFFILFPLVSFLMWTIGLIVLLGLWSTQDKWHTPSEPDPVYLSDMGAYTKGFFIPMCVITGVFYFLTFIMIRLARQWGWIYPTGRKVETYLGWFAALTGAAAASCLISLSIRDDVHHDNVHWKFTAAFVVLAFVSAASNIFEWLSATRYYPQSSLLRVSFIFKFVIIVVGIICAIAFGGLHHNYRGRSARFEWVVCFLWSIYICLLCLDLAPALFYDSLASAPDLEKGAYATSVPESYVAPMEPPAAVLPDGEERYATPDLVPDTTAQYPYASATEPGVSNIPETRPERPVVYNMDVSQTTTTTRPVLA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
249	Phosphorylation	PDLEKGAYATSVPES CCHHCCCCCCCCCHH	21.05	29996109
251	Phosphorylation	LEKGAYATSVPESYV HHCCCCCCCCCHHHC	19.99	29996109
252	Phosphorylation	EKGAYATSVPESYVA HCCCCCCCCCHHHCC	27.74	29996109
256	Phosphorylation	YATSVPESYVAPMEP CCCCCCHHHCCCCCC	20.88	25720772
257	Phosphorylation	ATSVPESYVAPMEPP CCCCCHHHCCCCCCC	10.04	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SFK1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SFK1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SFK1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of SFK1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.