UniProt ID | MAG1_SCHPO | |
---|---|---|
UniProt AC | Q92383 | |
Protein Name | DNA-3-methyladenine glycosylase 1 | |
Gene Name | mag1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 228 | |
Subcellular Localization | ||
Protein Description | Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine or 7-methyladenine from the damaged DNA polymer formed by alkylation lesions. Can release ethylated and propylated bases from DNA in addition to 3-methyladenine.. | |
Protein Sequence | MTLDIEEKEEIVTSLTKAEIHLSGLDENWKRLVKLVGNYRPNRSMEKKEPYEELIRAVASQQLHSKAANAIFNRFKSISNNGQFPTPEEIRDMDFEIMRACGFSARKIDSLKSIAEATISGLIPTKEEAERLSNEELIERLTQIKGIGRWTVEMLLIFSLNRDDVMPADDLSIRNGYRYLHRLPKIPTKMYVLKHSEICAPFRTAAAWYLWKTSKLADYTKPVRPKKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MAG1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MAG1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAG1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAG1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD13_SCHPO | rad13 | genetic | 10735851 | |
AGO1_SCHPO | ago1 | genetic | 18818364 | |
RHP41_SCHPO | rhp41 | genetic | 21670547 | |
FIN1_SCHPO | fin1 | genetic | 22681890 | |
MCA1_SCHPO | pca1 | genetic | 22681890 | |
REXO3_SCHPO | rex3 | genetic | 22681890 | |
ULP2_SCHPO | ulp2 | genetic | 22681890 | |
RICTR_SCHPO | ste20 | genetic | 22681890 | |
MAL3_SCHPO | mal3 | genetic | 22681890 | |
TLS1_SCHPO | tls1 | genetic | 22681890 | |
VIPI_SCHPO | vip1 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
BU107_SCHPO | bun107 | genetic | 22681890 | |
TPS2_SCHPO | tps2 | genetic | 22681890 | |
MU154_SCHPO | mug154 | genetic | 22681890 | |
YD62_SCHPO | SPAC17G8.02 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...