UniProt ID | AF9_SCHPO | |
---|---|---|
UniProt AC | Q10319 | |
Protein Name | Protein AF-9 homolog | |
Gene Name | yaf9 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 217 | |
Subcellular Localization | Cytoplasm. Nucleus . | |
Protein Description | Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histones H4 and H2A. The NuA4 complex is also involved in DNA repair. Yaf9 may also be required for viability in conditions in which the structural integrity of the spindle is compromised (By similarity).. | |
Protein Sequence | MAPNTRVSKCQISRPILVGNDAKPLTKEEKEKAPTDHTHTWRIFVEGVDGEDISKWVRKVVFKLHDTYNNPTRTIESPPFEVIETGWGEFDIMVRIFFAPEAHEKALTFYHHLKLHPYGPRMEEMKASGGLVESVQYEEIVFNEPFEYTYKLLSQNPIGDGHGLAVESEPDHPFSQQLEQDEADKLDFAIQEVKKTIEMYKQQVQSLQGQKSSTPVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AF9_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AF9_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AF9_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...