dbPTM

GMH2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GMH2_SCHPO
UniProt AC	Q09681
Protein Name	Probable alpha-1,2-galactosyltransferase gmh2
Gene Name	gmh2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	346
Subcellular Localization	Golgi apparatus membrane Single-pass type II membrane protein .
Protein Description
Protein Sequence	MALMLSRIPRRFFFLFLTVGLIAGAFLYSLIYFVDVDLVSKVNQLYDQQIAPMLSDAIGTPSVNHSFELAPLDSHLVATSTTFHEASYESEPQQNPASQNIVLLLVSDGHTSYNNGANTFEEAIQNRVDYSTKQNYNFEYVNVTGLPIPAVWSKMPAVLQTMKKYPKAEWIWLLDQDAIITNTHLSLQDSFLKPENLQKTLITNTILTKRPINANGDLRYTPSNYSLKDIENLMVIISQDHNGLNAGSILFRNSPATALFLDIWTDPVVAECAKANNEQDMLGYLISKHSQLASLVGLIPQRKINAFHEGPENMEWQKGDLVIHFAGCWVENRCDELWQKFYALID

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	N-linked_Glycosylation	AIGTPSVNHSFELAP HCCCCCCCCCEEECC	29.44	-
142	N-linked_Glycosylation	NYNFEYVNVTGLPIP CCCEEEEECCCCCCC	25.40	-
224	N-linked_Glycosylation	DLRYTPSNYSLKDIE CCCCCCCCCCHHHHH	31.45	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GMH2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GMH2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GMH2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GMH3_SCHPO	gmh3	genetic	21098516
YGWH_SCHPO	gmh4	genetic	21098516
YFE6_SCHPO	gmh5	genetic	21098516
YBKD_SCHPO	gmh6	genetic	21098516
COX19_SCHPO	SPCC1672.04c	genetic	22681890
ALG8_SCHPO	alg8	genetic	22681890
YEMD_SCHPO	SPAC29B12.13	genetic	22681890
SCE3_SCHPO	sce3	genetic	22681890
ALG12_SCHPO	alg12	genetic	22681890
SDS23_SCHPO	sds23	genetic	22681890
BDC1_SCHPO	bdc1	genetic	22681890
VAM7_SCHPO	SPCC594.06c	genetic	22681890
YFY2_SCHPO	SPAC9.02c	genetic	22681890
ALG6_SCHPO	alg6	genetic	22681890
DBR1_SCHPO	dbr1	genetic	22681890
ALG9_SCHPO	alg9	genetic	22681890
YE08_SCHPO	SPAC17H9.08	genetic	22681890
PPR2_SCHPO	ppr2	genetic	22681890
HMT2_SCHPO	hmt2	genetic	22681890
GBB_SCHPO	git5	genetic	22681890
YE98_SCHPO	erp2	genetic	22681890
ALG5_SCHPO	alg5	genetic	22681890
YF75_SCHPO	spa2	genetic	22681890
ATP5E_SCHPO	atp15	genetic	22681890
CYSK_SCHPO	cys11	genetic	22681890
MU172_SCHPO	msd1	genetic	22681890
RENT1_SCHPO	upf1	genetic	22681890
GLD1_SCHPO	gld1	genetic	22681890
TOM70_SCHPO	tom70	genetic	22681890
RL17B_SCHPO	rpl1702	genetic	22681890
YCG6_SCHPO	pus3	genetic	22681890
YNT3_SCHPO	SPBC9B6.03	genetic	22681890
MUG73_SCHPO	mug73	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GMH2_SCHPO

Related Literatures of Post-Translational Modification