| UniProt ID | CSK2A_SCHPO | |
|---|---|---|
| UniProt AC | P40231 | |
| Protein Name | Casein kinase II subunit alpha | |
| Gene Name | cka1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 332 | |
| Subcellular Localization | ||
| Protein Description | Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. Plays a role in the translation of cell polarity into polarized growth. The alpha and alpha' chains contain the catalytic site.. | |
| Protein Sequence | MNQTEAAPVVSVSRVYAHVNEEMPREYWDYENMQEVFGYQDNYEIIRKVGRGKYSEVFEGLNVLNNSKCIIKVLKPVKYKKIKREIKILQNLAGGPNIISLLDIVRDPESKTPSLIFEFVDNIDFRTLYPTLSDYDIRYYSYELLKALDFCHSRGIMHRDVKPHNVMIDHKKRKLRLIDWGLAEFYHAGMEYNVRVASRYFKGPELLVDFREYDYSLDIWSFGVMFAALIFKKDTFFRGRDNYDQLVKIAKVLGTDELFAYVQKYQIVLDRQYDNILGQYPKRDWYSFVNRDNRSLANDEAIDLLNRLLRYDHQERLTCQEAMAHPYFQVLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 54 | Phosphorylation | RKVGRGKYSEVFEGL HHHCCCCHHHHHHHC | 16.94 | 25720772 | |
| 55 | Phosphorylation | KVGRGKYSEVFEGLN HHCCCCHHHHHHHCC | 30.67 | 25720772 | |
| 295 | Phosphorylation | FVNRDNRSLANDEAI HCCCCCCCCCCHHHH | 37.78 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSK2A_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSK2A_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSK2A_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GOS1_SCHPO | gos1 | genetic | 22681890 | |
| MMS19_SCHPO | mms19 | genetic | 22681890 | |
| SOG2_SCHPO | sog2 | physical | 23462181 | |
| NAK1_SCHPO | nak1 | physical | 23462181 | |
| CSK2B_SCHPO | ckb1 | physical | 23462181 | |
| CSK2C_SCHPO | ckb2 | physical | 23462181 | |
| RRN7_SCHPO | rrn7 | physical | 25410910 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
