dbPTM

ERFD_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERFD_SCHPO
UniProt AC	Q10182
Protein Name	Ras modification protein erf4
Gene Name	erf4
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	172
Subcellular Localization	Endoplasmic reticulum membrane Peripheral membrane protein .
Protein Description	The erf2-erf4 complex is a palmitoyltransferase specific for Ras proteins. Palmitoylates RAS2, which is required for its proper plasma membrane localization (By similarity). Has a role in meiosis..
Protein Sequence	MLVRIERDYSVSGDKYPQFPTDYPVPLRAYVNLEDWDVFIHTLNEKLREAFCPWSIGNLLDGILSVLTIYISEFVFGSIHRKRIGAIDLYILDFATQHNLYVASLRNMGFLSLVFHTKETNSKSSTLHSNPYCPEHHSIRTLPSAVTATTSNISTSSSHRSDLPNEWTNSTL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ERFD_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERFD_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERFD_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERFD_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RHO3_SCHPO	rho3	genetic	23843742

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERFD_SCHPO

Related Literatures of Post-Translational Modification