| UniProt ID | IES2_SCHPO | |
|---|---|---|
| UniProt AC | O14210 | |
| Protein Name | INO80 complex subunit 2 | |
| Gene Name | ies2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 295 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair.. | |
| Protein Sequence | MARRRSTRRALVETPSDLNAQDSDSLSVSTKEELGDDALAAEEGQSVLDEQEIEEALEEDDTNYEEDIIDDEESAQVDEEELEEEEEEEEDATPEPVVTSKKNSRSKPKNGGASKRKASRRTVVDEDSENLEGDEEDGSFSDLKDLYSNPMPAQTTPVSMRMTKRQRAIQGILEEGEEDELLELPPETSGRKKLTPEEMALRRIENARRRKNQSERRLEEEKMETINRLLKRQSNTGKPRRGRAPNNPTSDSISRSKAVPKDRINMYQPFQCVRFKSTKEGSSLGVPEPLIRFFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | SDLNAQDSDSLSVST CCCCCCCCCCCCCCC | 28889911 | ||
| 119 | Phosphorylation | GASKRKASRRTVVDE CCCCCHHHCCEEECC | 21712547 | ||
| 122 | Phosphorylation | KRKASRRTVVDEDSE CCHHHCCEEECCCHH | 21712547 | ||
| 128 | Phosphorylation | RTVVDEDSENLEGDE CEEECCCHHCCCCCC | 28889911 | ||
| 139 | Phosphorylation | EGDEEDGSFSDLKDL CCCCCCCCCHHHHHH | 21712547 | ||
| 141 | Phosphorylation | DEEDGSFSDLKDLYS CCCCCCCHHHHHHHC | 21712547 | ||
| 147 | Phosphorylation | FSDLKDLYSNPMPAQ CHHHHHHHCCCCCCC | 29996109 | ||
| 148 | Phosphorylation | SDLKDLYSNPMPAQT HHHHHHHCCCCCCCC | 29996109 | ||
| 155 | Phosphorylation | SNPMPAQTTPVSMRM CCCCCCCCCCCCHHC | 24763107 | ||
| 156 | Phosphorylation | NPMPAQTTPVSMRMT CCCCCCCCCCCHHCH | 21712547 | ||
| 159 | Phosphorylation | PAQTTPVSMRMTKRQ CCCCCCCCHHCHHHH | 29996109 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IES2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IES2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IES2_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
