UniProt ID | IVN1_SCHPO | |
---|---|---|
UniProt AC | Q96WW4 | |
Protein Name | Invasion protein 1 | |
Gene Name | ivn1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 371 | |
Subcellular Localization |
Endoplasmic reticulum . Membrane Multi-pass membrane protein . |
|
Protein Description | Required for invasive growth.. | |
Protein Sequence | MSQTEIVKKPKHKRFKRPDKSRFVQQTLPAWQFIFTPWTVLPLLFLLGIVFAPLGAGMFVASRRVKELRIDYTDCMNIGDEFKQVPSTNIEFQYKNVKNVTAMWKSSGDVCTLRFQIPEEMTSPVFAFYRLKNFYQNHRRYTVSADMFQLLGEARTVAQLKSYGFCKPLEANEEGKPYYPCGIIANSLFNDSYSSLLRYESFDSSNSLGLYNMTTNGTAWPEDRERYKKTKYNASQIVPPPNWAKMFPNGYTDDNIPDVSTWDAFQIWMRAAALPTFSKLALRNVTTALQPGIYEMNITYNFPVTEYKGTKTIMFSTTSVIGGKNYFLGILYFVIGGLCAASGVILSIACLIKPRRVGDPRYLSWNRGKSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
99 | N-linked_Glycosylation | FQYKNVKNVTAMWKS EEEECCEEEEEEEEC | - | ||
190 | N-linked_Glycosylation | IIANSLFNDSYSSLL EEEHHHCCCCHHHHH | - | ||
212 | N-linked_Glycosylation | SNSLGLYNMTTNGTA CCCEEEEECCCCCCC | - | ||
216 | N-linked_Glycosylation | GLYNMTTNGTAWPED EEEECCCCCCCCHHH | - | ||
233 | N-linked_Glycosylation | RYKKTKYNASQIVPP HHHHCCCCHHHCCCC | - | ||
284 | N-linked_Glycosylation | FSKLALRNVTTALQP HHHHHHHHCHHHCCC | - | ||
297 | N-linked_Glycosylation | QPGIYEMNITYNFPV CCCEEEEEEEEEEEE | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IVN1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IVN1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IVN1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YEG5_SCHPO | mga2 | genetic | 19547744 | |
PST2_SCHPO | pst2 | genetic | 19547744 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...