| UniProt ID | NTH_SCHPO | |
|---|---|---|
| UniProt AC | Q09907 | |
| Protein Name | Endonuclease III homolog {ECO:0000255|HAMAP-Rule:MF_03183} | |
| Gene Name | nth1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 355 | |
| Subcellular Localization | Nucleus . Mitochondrion . | |
| Protein Description | Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines. Has also 8-oxo-7,8-dihydroguanine (8-oxoG) DNA glycosylase activity. Also involved in the repair of 7-methylguanine lesions, although it cannot directly repair alkylated DNA bases. Probably does so via excision of methylformamidopyrimidine (mFapy) lesions, a spontaneous processing product of 7-methylguanine.. | |
| Protein Sequence | MSKDYGTPPENWREVYDEICKMKAKVVAPVDVQGCHTLGERNDPKKFRFQTLVALMLSSQTKDIVLGPTMRNLKEKLAGGLCLEDIQNIDEVSLNKLIEKVGFHNRKTIYLKQMARILSEKFQGDIPDTVEDLMTLPGVGPKMGYLCMSIAWNKTVGIGVDVHVHRICNLLHWCNTKTEEQTRAALQSWLPKELWFELNHTLVGFGQTICLPRGRRCDMCTLSSKGLCPSAFKEKSGITITKRKVKTIKRVKKRPASESPPLSPLSLPTDDLYYQSIEDKSLIKLEDLDPVDSISHMNEPLKKEPAADIDVDQKPPVAFHSTTKETRSLRRSKRVAKKSSQYFSQQSLQDIEDLV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 257 | Phosphorylation | RVKKRPASESPPLSP HHHCCCCCCCCCCCC | 21712547 | ||
| 259 | Phosphorylation | KKRPASESPPLSPLS HCCCCCCCCCCCCCC | 24763107 | ||
| 263 | Phosphorylation | ASESPPLSPLSLPTD CCCCCCCCCCCCCCC | 24763107 | ||
| 266 | Phosphorylation | SPPLSPLSLPTDDLY CCCCCCCCCCCCCCE | 29996109 | ||
| 269 | Phosphorylation | LSPLSLPTDDLYYQS CCCCCCCCCCCEECC | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NTH_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NTH_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NTH_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
