ATG10_SCHPO - dbPTM
ATG10_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID ATG10_SCHPO
UniProt AC Q9UTD5
Protein Name Ubiquitin-like-conjugating enzyme ATG10
Gene Name ATG10
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 179
Subcellular Localization Cytoplasm . Nucleus . Preautophagosomal structure membrane
Peripheral membrane protein .
Protein Description E2-like enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy and nucleophagy. Acts as an E2-like enzyme that catalyzes the conjugation of ATG12 to ATG5. ATG12 conjugation to ATG5 is required for proper localization of ATG8 to the preautophagosomal structure (PAS). Likely serves as an ATG5-recognition molecule..
Protein Sequence MSFKSQLLILAQKLSKGGISCELIEFDECILKLEWHTELLDKNDSLLYEQEEDDILSLMNPMITMHAWIRDSPSFEVPQFFFQPYANGSDPLTKMEQIFELLEGSSQNLAYDALAIGDCPGTVGIAWYIHPCRTRDYFEMLQIDKEDPKYLSLWLLYIHQVLSPLTQPIIKAVDDAEKS
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of ATG10_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of ATG10_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of ATG10_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of ATG10_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of ATG10_SCHPO !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of ATG10_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP