| UniProt ID | SNF30_SCHPO | |
|---|---|---|
| UniProt AC | Q9P7S6 | |
| Protein Name | SWI/SNF chromatin-remodeling complex subunit snf30 | |
| Gene Name | snf30 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 274 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Component of the SWI/SNF complex, an ATP-dependent chromatin remodeling complex, required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.. | |
| Protein Sequence | MSFVSKSPPIVNSASPTGQVNPMEVEKANKLLEINRLILWKCLELQHIKTAQNSTLEQRALSTELFNSYIQRLKANLAFVVSIASPRQMQVLTPPLSCPESLPQLEPLYKELRQYFQIAQTSTLSYPPSNGDSSSYANGTDLHGNTGTMQQEEKANPSLTRSDSVSSGSYITMQGANSLKAQQDLLNSFTGAPSNNSHNIPDPNLSQTFSATSMGPPNNNYSKFRTDNYLARSSNRSGTPNIQNEQSRFFDSQQAQVQARALMQRYQQGMEFNK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSFVSKSPP ------CCCCCCCCC | 34.06 | 29996109 | |
| 5 | Phosphorylation | ---MSFVSKSPPIVN ---CCCCCCCCCCCC | 25.96 | 29996109 | |
| 7 | Phosphorylation | -MSFVSKSPPIVNSA -CCCCCCCCCCCCCC | 28.53 | 29996109 | |
| 166 | Phosphorylation | LTRSDSVSSGSYITM CCCCCCCCCCCEEEE | 32.69 | 24763107 | |
| 237 | Phosphorylation | LARSSNRSGTPNIQN HHCCCCCCCCCCCCC | 51.79 | 29996109 | |
| 239 | Phosphorylation | RSSNRSGTPNIQNEQ CCCCCCCCCCCCCCH | 17.89 | 29996109 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNF30_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNF30_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNF30_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SNF22_SCHPO | snf22 | physical | 18622392 | |
| SOL1_SCHPO | sol1 | physical | 18622392 | |
| SNF5_SCHPO | snf5 | physical | 18622392 | |
| SSR1_SCHPO | ssr1 | physical | 18622392 | |
| ARP9_SCHPO | arp9 | physical | 18622392 | |
| SNF59_SCHPO | snf59 | physical | 18622392 | |
| SSR2_SCHPO | ssr2 | physical | 18622392 | |
| ARP42_SCHPO | arp42 | physical | 18622392 | |
| SSR3_SCHPO | ssr3 | physical | 18622392 | |
| SSR4_SCHPO | ssr4 | physical | 18622392 | |
| SNF30_SCHPO | snf30 | physical | 18622392 | |
| TAF14_SCHPO | tfg3 | physical | 18622392 | |
| HRR1_SCHPO | hrr1 | genetic | 18818364 | |
| VPH2_SCHPO | vph2 | genetic | 18818364 | |
| PMP1_SCHPO | pmp1 | genetic | 18818364 | |
| HIR1_SCHPO | hip1 | genetic | 18818364 | |
| HPC2_SCHPO | hip4 | genetic | 18818364 | |
| SET1_SCHPO | set1 | genetic | 18818364 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
