UniProt ID | SSR4_SCHPO | |
---|---|---|
UniProt AC | Q9P7Y0 | |
Protein Name | SWI/SNF and RSC complexes subunit ssr4 | |
Gene Name | ssr4 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 395 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Component of the chromatin structure remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. Controls particularly membrane and organelle development genes. Part of the SWI/SNF complex, an ATP-dependent chromatin remodeling complex, required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.. | |
Protein Sequence | MAATMAAQSLLSIPVEYRSQVWCRANLPYPPAPQLPIPAVVDILTKASQALPQISFSWTLIDQPPDGSLFLVWQAPTLPSPPDGMHFMSNERFFNMDVAGKVLEIHEAKHGFYPLSETRTMHVRCRYRLLGVGFDNFWLVHYFQGSETDSIPANISVAKPPHLRRYPLPDVKTSPFLLQEPKKHIPEGTALSQRETLPNMGSAQMKSQSRTPSFSNVTTSPVPPINSNATAQTAEGHMGATNMTVDNMNKPSIPPNGNTSILMQEDLEIEKGDVMDKLSPQQICTARFIKHAEWMSQVLLTLQSVKDIEPPALWQEPNSMEELGKELKDNKEQLVKQDQKYQSLQGDLSYTDSMSNLLKEFSNIKSAEECDVLQKKIEEFAEAKIVPLSHVTERS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
213 | Phosphorylation | KSQSRTPSFSNVTTS HCCCCCCCCCCCCCC | 40.47 | 27738172 | |
220 | Phosphorylation | SFSNVTTSPVPPINS CCCCCCCCCCCCCCC | 17.97 | 27738172 | |
279 | Phosphorylation | GDVMDKLSPQQICTA CCHHHHCCHHHHHHH | 26.80 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSR4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSR4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSR4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SSR4_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...