TAF14_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TAF14_SCHPO
• UniProt AC: O94436
• Protein Name: Transcription initiation factor TFIID subunit 14
• Gene Name: tfg3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 241
• Subcellular Localization: Nucleus, nucleoplasm .
• Protein Description: Functions as a component of the DNA-binding general transcription factor complex TFIID, and the RNA polymerase II associated general transcription factor complex TFIIF. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, facilitation of DNA opening and initiation of transcription. TFIIF is essential for the initiation of transcription by RNA polymerase II. TFIIF functions include the recruitment of RNA polymerase II to the promoter bound DNA-TBP-TFIIB complex, decreasing the affinity of RNA polymerase II for non-specific DNA, allowing for the subsequent recruitment of TFIIE and TFIIH, and facilitating RNA polymerase II elongation. The TAF14 subunit has stimulatory activity. Component of the SWI/SNF complex, an ATP-dependent chromatin remodeling complex, required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. Component of the mst2 complex which is a highly specific H3 lysine 14 (H3K14) acetyltransferase that functions together with gcn5 to regulate global levels of H3K14 acetylation (H3K14ac), critical for DNA damage checkpoint activation..
• Protein Sequence: MTTVKRTVRLITDQNVLPGGEAAVLNDQSFPVREWSIKLVCLNPQGEETDASFVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYADKGGEHRFLHYLHFQQEHYHEDIELNINATRPGLLKALTATGEVPGYSDEGEEARKDKRKNESEVGAGKKKAKAKPVDMDKLAEGLQKLQEDDLLQVVQMVNENKTPDMYVRNDIEGGEFHIDLYTLPDNLLLLLYSFCAKRVTM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
135	Phosphorylation	PGLLKALTATGEVPG HHHHHHHHHCCCCCC	27.34	24763107
144	Phosphorylation	TGEVPGYSDEGEEAR CCCCCCCCCCCHHHH	34.79	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TAF14_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TAF14_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TAF14_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YJA1_SCHPO	SPCC1529.01	genetic	15616156
YBH9_SCHPO	SPBC3B8.09	genetic	15616156
JMJ1_SCHPO	jmj1	genetic	15616156
MAS5_SCHPO	mas5	genetic	15616156
UBC9_SCHPO	hus5	genetic	15616156
TBP_SCHPO	tbp1	physical	15616156
TF2B_SCHPO	sua7	physical	15616156
TAF14_SCHPO	tfg3	physical	15616156
T2FB_SCHPO	tfg2	physical	15616156

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.