UBC9_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBC9_SCHPO
• UniProt AC: P40984
• Protein Name: SUMO-conjugating enzyme ubc9
• Gene Name: hus5
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 157
• Subcellular Localization: Nucleus .
• Protein Description: Catalyzes the covalent attachment of ubiquitin-like protein SUMO/Smt3 to other proteins. Required for efficient recovery from DNA damage or S-phase arrest and normal mitosis. This may be as part of a checkpoint independent recovery process..
• Protein Sequence: MSSLCKTRLQEERKQWRRDHPFGFYAKPCKSSDGGLDLMNWKVGIPGKPKTSWEGGLYKLTMAFPEEYPTRPPKCRFTPPLFHPNVYPSGTVCLSILNEEEGWKPAITIKQILLGIQDLLDDPNIASPAQTEAYTMFKKDKVEYEKRVRAQARENAP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of UBC9_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBC9_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of UBC9_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBC9_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAD22_SCHPO	rad52	physical	11600706
SWI6_SCHPO	swi6	physical	16168376
CLR4_SCHPO	clr4	physical	16168376
WEE1_SCHPO	wee1	genetic	7768995
RIR1_SCHPO	cdc22	genetic	7768995
CHK1_SCHPO	chk1	genetic	7768995
RAD22_SCHPO	rad52	physical	12597774
RAD60_SCHPO	rad60	physical	21444718
PMT3_SCHPO	pmt3	physical	21444718

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.