SSR1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SSR1_SCHPO
• UniProt AC: O13788
• Protein Name: SWI/SNF and RSC complexes subunit ssr1
• Gene Name: ssr1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 527
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the chromatin structure remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. Controls particularly membrane and organelle development genes. Part of the SWI/SNF complex, an ATP-dependent chromatin remodeling complex, required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors..
• Protein Sequence: MSNVTENKHDLHENGVPDSAQPMELDVSKKEDTEPEVRDEAKEFLLSQLPQVEVPEWAQWFDFSKVHEIEKKQNPEFFDGKNTSKTPEVYKEYRDFMISTFRLNSKVYLTFTACRRNLAGDVCAVLRVHRFLEQWGLINYNVNPDTRPSKIGPPSTSHFQILADTPRGLVPLLPPPSSSIPRSKAVTIEDPSIVRTNIYDPSLDDVLKGKGSTPNQKPSLSNLHENNIDQSDSPQHCYCCGNKFNESYYQSQTAQKYNVCISCYQQNRFPSPTTIADYKEVAIQNKIEDDDTWTAQELVLLSEGVEMYSDDWAKVASHVNTKSVEECILKFLNLPSSDKALFKMDKVHTNPVVDSLQGKNPILSVVSFLAKMVPPSSFTQKSSAKEEESDKVKGESVYPKPESESYDVEMNGKSLEDSDSLSELYLTNEEKKMASIIKDSVNVQIKLIESKLSHFDYLDQHIRLKSQELDAFAQATYREKLYMKRECQNARKKIEQQLQSKDTAANGLPVQSSAETSVIPASSMSPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
271	Phosphorylation	YQQNRFPSPTTIADY ECCCCCCCCCCCCCH	31.97	28889911
418	Phosphorylation	NGKSLEDSDSLSELY CCEECCCCCCHHHHH	21.52	24763107
420	Phosphorylation	KSLEDSDSLSELYLT EECCCCCCHHHHHCC	37.43	25720772
422	Phosphorylation	LEDSDSLSELYLTNE CCCCCCHHHHHCCCH	29.52	28889911
522	Phosphorylation	ETSVIPASSMSPS-- CCCEECHHHCCCC--	22.63	21712547
523	Phosphorylation	TSVIPASSMSPS--- CCEECHHHCCCC---	25.94	21712547
525	Phosphorylation	VIPASSMSPS----- EECHHHCCCC-----	24.76	24763107
527	Phosphorylation	PASSMSPS------- CHHHCCCC-------	45.61	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SSR1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SSR1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SSR1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MDV1_SCHPO	caf4	physical	26771498
SNX4_SCHPO	SPAC6F6.12	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.