SNX4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNX4_SCHPO
• UniProt AC: O14243
• Protein Name: Sorting nexin-4
• Gene Name: snx4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 401
• Subcellular Localization: Cytoplasm. Membrane; Peripheral membrane protein. Endosome membrane; Peripheral membrane protein. Endosome and other perivacuolar punctate structures..
• Protein Description: Sorting nexin, involved in the separation or division of vacuoles throughout the entire life cycle of the cells. Involved in retrieval of late-Golgi SNAREs from post-Golgi endosomes to the trans-Golgi network, for cytoplasm to vacuole transport (Cvt), mitophagy, and pexophagy (By similarity)..
• Protein Sequence: MSDSVNLDEPSTNSTHFLQCLVTEPRKELQGSRDTHVSYLIITKTNLSIFTRAECKVRRRFSDFVKLQEILSRMNEDCVVPPLPAKHKLEYIKGGRFSDNFINRRAKLLNRYITRCALHPVLHQSPHFIAFLENPNWNNYVRFFIQPKLNNTSKLDEISDSLLNAFSKLKEEPTEFDIQRDHVQQFMFGISNLEGSIQKLLRLEKALESDYEDVSIQFDRLASLDQALDVPIESIQNALQQTGTEYANLTEKLTLLLDTIKDVESYAHSLKELLKRRDQKQQDVEALQEYSAKLSLERDKISSGGSNGFSLSKTLDDLRGIDHNDTRLKRLEHVQSELQAVEQAIQEASAVHDAFNQRVREESKLFDSVRQSEMLSAISDYANVHVEFFTNIRDLWIRVKQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDSVNLDE ------CCCCCCCCC	38.30	21712547
4	Phosphorylation	----MSDSVNLDEPS ----CCCCCCCCCCC	12.95	29996109
62	Phosphorylation	CKVRRRFSDFVKLQE HHHHHHHHHHHHHHH	28.47	28889911
159	Phosphorylation	TSKLDEISDSLLNAF CCHHHHHHHHHHHHH	21.06	25720772
161	Phosphorylation	KLDEISDSLLNAFSK HHHHHHHHHHHHHHH	28.15	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNX4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNX4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNX4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADN2_SCHPO	adn2	physical	26771498
SNX41_SCHPO	mug186	physical	26771498
CBH2_SCHPO	cbh2	physical	26771498
YH7G_SCHPO	SPBC16G5.16	physical	26771498
TAS3_SCHPO	tas3	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-62, AND MASSSPECTROMETRY.
PubMed: 18257517