| UniProt ID | MIK1_SCHPO | |
|---|---|---|
| UniProt AC | P30290 | |
| Protein Name | Mitosis inhibitor protein kinase mik1 | |
| Gene Name | mik1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 581 | |
| Subcellular Localization | ||
| Protein Description | Protein kinase that acts both on serines and on tyrosines. It acts as a negative regulator of entry into mitosis (G2 to M transition). Phosphorylates and inhibits cdc2.. | |
| Protein Sequence | MDSSTTIPITPTRTPCFFNISSSFNEHSPLNFYDEPIYNFSSGHEENQSHKSSKLTFFKPSNTKRSPHTPMQNNAKAIRLSTTVRHGIFKNSDLDGCSKPFAFSSGLKLSKKIVDASTPIDLKRKRAVTSLSTGLLSKREKWSLWEGNLTNPRSEQPHTPCKKGTKIKLKPPQSPLSPTTSLLARKCKHIDLDTFSRLDHPNSDSSDETFEMEELPSLSYGSEDLLEFCETPCKSQPIFLSSSHVNNWDEKDVPSSLSWTPTSPIFLNINSADDYEEEEDWTSDLRIRFQQVKPIHESDFSFVYHVSSINPPTETVYVVKMLKKNAAKFTGKERHLQEVSILQRLQACPFVVNLVNVWSYNDNIFLQLDYCENGDLSLFLSELGLLQVMDPFRVWKMLFQLTQALNFIHLLEFVHLDVKPSNVLITRDGNLKLGDFGLATSLPVSSMVDLEGDRVYIAPEILASHNYGKPADVYSLGLSMIEAATNVVLPENGVEWQRLRSGDYSNLPNLKDLLLSKEKVQINKVRCAESLQCLLQRMTHPYVDCRPTTQDLLAMPEMIFISEHSQKAAIIYEDHNSWLET | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 129 | Phosphorylation | LKRKRAVTSLSTGLL HHHHHHHHHHHHCCC | 23.98 | 21712547 | |
| 130 | Phosphorylation | KRKRAVTSLSTGLLS HHHHHHHHHHHCCCC | 17.45 | 24763107 | |
| 132 | Phosphorylation | KRAVTSLSTGLLSKR HHHHHHHHHCCCCCH | 21.87 | 24763107 | |
| 133 | Phosphorylation | RAVTSLSTGLLSKRE HHHHHHHHCCCCCHH | 36.82 | 21712547 | |
| 137 | Phosphorylation | SLSTGLLSKREKWSL HHHHCCCCCHHHHCC | 34.41 | 21712547 | |
| 174 | Phosphorylation | IKLKPPQSPLSPTTS CCCCCCCCCCCHHHH | 33.31 | 24763107 | |
| 177 | Phosphorylation | KPPQSPLSPTTSLLA CCCCCCCCHHHHHHH | 24.47 | 24763107 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MIK1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MIK1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MIK1_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
