WOS2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WOS2_SCHPO
• UniProt AC: Q11118
• Protein Name: Protein wos2
• Gene Name: wos2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 186
• Protein Description: Cell cycle regulatory protein that interacts with cdc2 in the control of the M-G1 transition..
• Protein Sequence: MSLNTQIPEVLWAQRSNKDDAEKNVIYLTVLIPDAVDPKINLTPEKLVIDSKSGANAHYAVQIDFFKDIDVEKSKYSVTGRYIFFVLYKKELQEEFWPRLTKEKLRLHWLRTDFDRWVDEDEQEAQPEVSPFGAGGMPDLSALGGMGGMDFSQFGNLGGAGAGEDASDSEPELEEEEEVGSNEKKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	EVLWAQRSNKDDAEK HHHHHHHCCCCHHHH	35.83	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WOS2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WOS2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WOS2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDK1_SCHPO	cdc2	physical	10581266
POP1_SCHPO	pop1	physical	26771498
PPT1_SCHPO	SPBC3F6.01c	physical	26771498
MTXL_SCHPO	SPBC409.19c	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.