| UniProt ID | FIO1_SCHPO | |
|---|---|---|
| UniProt AC | Q09920 | |
| Protein Name | Iron transport multicopper oxidase fio1 | |
| Gene Name | fio1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 622 | |
| Subcellular Localization |
Cell membrane Single-pass type I membrane protein Extracellular side. |
|
| Protein Description | Could be a iron transport multicopper oxidase, which is required for Fe(2+) high affinity uptake. May be required to oxidize Fe(2+) and release it from the transporter. Essential component of copper-dependent iron transport.. | |
| Protein Sequence | MNKFFSFPILGLLLTCVRFVVAKERLFEWNVTDVYDVDPDGSGNSRWVIGVNNKWPIDPLVVDYGDQVIIKMTNSLANNRTTSLHSHGLFQKFTPYMDGVPQSTQCEIPPGATFYYNYTALQNGTYWVHSHDMSQYPDGLRTPFIINALEEPYDYDEEYIISMTDWYYTPFNILVPDEFKTWKNPTGAEPVPDTGLFNDTANATFAMEPGKTYRLRFINIGAFNNYDVMIEDHNMTIIEVDGEYTEPQEVSSIHLTVAQRYSVLVTAKNSTDRNYAITAYMDESLFDTIPDNYNPNVTAWLSYNSDASYDLGPDIDEIDSYDDAELNPLYSWDVTESNHSINIWFDFFTLGDGANYAEINDSSYVFPKVPSIMIANSTNVDGYNLEPVTYGPYTNAYIFEYGDVVDVIIDNHDTGKHPFHLHGHTFQVLERGEENAGLYSDQESHTYYDNPMRRDTVEIEPGSFIVIRFIADNPGAWVIHCHIEWHMESGLLATFIEAPEMIPSISSPDFVKEQCMLDGVPTIGNGAGNYKNISDLSGAPSPPGEMPAGWTSKAIGTMAACVISACIGMGSIIFYGASIHPVPTEELDENDDLQEAALENAAMFLDTDKAVEKVVEGKDEIK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | N-linked_Glycosylation | KERLFEWNVTDVYDV HHHHHCCCCCEEEEE | 21.44 | - | |
| 79 | N-linked_Glycosylation | MTNSLANNRTTSLHS CCHHHCCCCCCCCHH | 36.75 | - | |
| 117 | N-linked_Glycosylation | PGATFYYNYTALQNG CCCEEEEEEEECCCC | 19.12 | - | |
| 123 | N-linked_Glycosylation | YNYTALQNGTYWVHS EEEEECCCCEEEEEC | 45.70 | - | |
| 198 | N-linked_Glycosylation | VPDTGLFNDTANATF CCCCCCCCCCCCCEE | 51.25 | - | |
| 202 | N-linked_Glycosylation | GLFNDTANATFAMEP CCCCCCCCCEECCCC | 41.42 | - | |
| 234 | N-linked_Glycosylation | DVMIEDHNMTIIEVD EEEEECCCEEEEEEC | 41.43 | - | |
| 269 | N-linked_Glycosylation | SVLVTAKNSTDRNYA EEEEEECCCCCCCEE | 47.91 | - | |
| 296 | N-linked_Glycosylation | IPDNYNPNVTAWLSY CCCCCCCCCEEEEEE | 39.88 | - | |
| 338 | N-linked_Glycosylation | SWDVTESNHSINIWF EEECCCCCCEEEEEE | 27.05 | - | |
| 360 | N-linked_Glycosylation | GANYAEINDSSYVFP CCCEEEECCCCCCCC | 34.32 | - | |
| 376 | N-linked_Glycosylation | VPSIMIANSTNVDGY CCEEEEECCCCCCCC | 38.14 | - | |
| 532 | N-linked_Glycosylation | NGAGNYKNISDLSGA CCCCCCCCHHHCCCC | 28.74 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FIO1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FIO1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FIO1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FIO1_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
