dbPTM

MEI3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MEI3_SCHPO
UniProt AC	P08090
Protein Name	21 kDa protein inducing meiosis and sporulation
Gene Name	mei3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	148
Subcellular Localization
Protein Description	This protein, expressed under control of the mating-type locus, induces meiosis and sporulation in fission yeast. It down regulates the ran1/pat1 gene product..
Protein Sequence	MSSQNTSNSRHPASSASALPNRTNTARRSTSPRTSTGSSSTNTNTKTVDHAGTTFISSTSKRGRSTKAGSVHSVPMKRTKRVRRTPAQRIEHENKENIQTEKVYRIKPVQRVLSPSDLTNELTILDLFHVPRPNETFDITDRVNNTSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MEI3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MEI3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MEI3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MEI3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAN1_SCHPO	ran1	physical	9799254
RAN1_SCHPO	ran1	physical	3357510
RAN1_SCHPO	ran1	physical	23695164
RAN1_SCHPO	ran1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MEI3_SCHPO

Related Literatures of Post-Translational Modification