ARLY_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARLY_SCHPO
• UniProt AC: P40369
• Protein Name: Argininosuccinate lyase
• Gene Name: arg7
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 461
• Protein Sequence: MAEKSSKKLWGGRFSGATDPLMAEFNKSIYSGKEMCEEDVIGSMAYAKALCQKNVISEEELNSILKGLEQIQREWNSGQFVLEPSDEDVHTANERRLTEIIGDVAGKLHTGRSRNDQVTTDLRLWLCRKIKEVEVYVINLLKVFTNRAEMEIDVIMSGYTHLQRAQPVRWSHFLMSHALPLLGDLGRLRQLYTRVSQLPLGAGALAGNPFNVDREFLRKELGFEGIIMNSMNAVGDRDFVIEFMFWAGMVMLHISRFAEDLIIYSSSEFGFVTLSDAYSTGSSIMPQKKNPDSLELLRGKSGRVLGDMIGLMITVKGTPTTYNKDLQEDKEPLFDAFKTVSDSLQILTGVVSTLTINPTKIAESLTPDLLATDLAEYLVRKGLPFRQTHHISGSAVRMAEERNTTLDKLSVSDLQSLHPLFDEDVSKVFNYEESVEKRCSIGGTAKHCVQEQIEHIRSAIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	KLWGGRFSGATDPLM CCCCCCCCCCCCHHH	26.59	25720772
410	Phosphorylation	NTTLDKLSVSDLQSL CCCCCCCCHHHHHHH	25.89	25720772
412	Phosphorylation	TLDKLSVSDLQSLHP CCCCCCHHHHHHHCH	29.27	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ARLY_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARLY_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARLY_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARLY_SCHPO	arg7	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.