UniProt ID | IEC3_SCHPO | |
---|---|---|
UniProt AC | O94704 | |
Protein Name | INO80 complex subunit 3 | |
Gene Name | iec3 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 168 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair.. | |
Protein Sequence | MASVKSFKRKYLKLRKSFDSVVLETEEIEQKIAEISEVYRRILLENAHLNDLLIDMNSTVLPTPPASPPGSPYWEAKPVSHTVFLESPSDVFTLEKPIASTHRWLSKLTALSKSTNSTLSTPKSFHSPLQSRGISPSSAQSSAAVSSSRKQKRKRTSEGPSERRARKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | KYLKLRKSFDSVVLE HHHHHHHHCCEEEEC | 25720772 | ||
87 | Phosphorylation | SHTVFLESPSDVFTL CEEEEECCHHHCEEE | 24763107 | ||
124 | Phosphorylation | STLSTPKSFHSPLQS CCCCCCCCCCCCHHH | 21712547 | ||
127 | Phosphorylation | STPKSFHSPLQSRGI CCCCCCCCCHHHCCC | 28889911 | ||
131 | Phosphorylation | SFHSPLQSRGISPSS CCCCCHHHCCCCHHH | 21712547 | ||
135 | Phosphorylation | PLQSRGISPSSAQSS CHHHCCCCHHHHHHH | 28889911 | ||
137 | Phosphorylation | QSRGISPSSAQSSAA HHCCCCHHHHHHHHH | 27738172 | ||
157 | Phosphorylation | KQKRKRTSEGPSERR HHHHHCCCCCHHHHH | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IEC3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IEC3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IEC3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IEC3_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...