YC0H_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YC0H_SCHPO
• UniProt AC: P87242
• Protein Name: HD domain-containing protein C4G3.17
• Gene Name: SPCC4G3.17
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 198
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MNAAKSLSIVPFLDCLSRLKTTPRTGWLYHGIEKPESIADHMYRMGILTMLCNDPSINKERCLKIAVVHDMAESIVGDITPHENVSKEEKHRMESEAMVSITQQLIPLNLSLQAEEIKELFLEYESASTPEAKFVKDIDKFEMIAQMFEYERKFNGEKDLSQFTWAGKLIQHPLVKGWLNDVLQEREQFWASVRQKKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YC0H_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YC0H_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YC0H_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YC0H_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DDB1_SCHPO	ddb1	genetic	22681890
YAS2_SCHPO	csr102	genetic	22681890
YC93_SCHPO	SPCC584.03c	genetic	22681890
RRP1_SCHPO	nop52	genetic	22681890
YC0H_SCHPO	SPCC4G3.17	physical	23695164
YC0H_SCHPO	SPCC4G3.17	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.