S2538_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S2538_SCHPO
• UniProt AC: Q9P6N6
• Protein Name: Mitochondrial glycine transporter {ECO:0000255|HAMAP-Rule:MF_03064}
• Gene Name: SPAC823.10c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 296
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Mitochondrial glycine transporter that imports glycine into the mitochondrial matrix. Plays an important role in providing glycine for the first enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) in the mitochondrial matrix..
• Protein Sequence: MSEIKKTEKLGVKSSKHLAAGALGGFISSTTLQPLDLLKTRCQQSQRDSLPKMVRRIILHEGGVFSLWKGTLPSILRSTTGSSCYFYFLNWLRHFAPQSKNIASSHIQNLWMGGFARAAVGFAFMPVTVIKVRYESNLYSYTTIYSSIRDIWKKEGISGFFRGFGVTALRDAPHAGLYVYFYELSKQNLHKLFDRFSPSSSVQGTVPHRNIVNVMSGLISGATATAITNPFDMLKTRVQLEPHIYKNFLHSAKLVYANEGFRGFLDGFFLRVLRKSISSTITWSVYEWALHRKVIK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	Phosphorylation	QPLDLLKTRCQQSQR CHHHHHHHHHHHHHH	36.32	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S2538_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S2538_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S2538_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of S2538_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.