dbPTM

ADA2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ADA2_SCHPO
UniProt AC	Q9P7J7
Protein Name	Transcriptional adapter 2
Gene Name	ada2 {ECO:0000250\|UniProtKB:Q02336}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	437
Subcellular Localization	Nucleus .
Protein Description	Functions as component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA and ADA. SAGA is involved in RNA polymerase II-dependent transcriptional regulation. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation (gcn5) and deubiquitination (ubp8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SALSA, an altered form of SAGA, may be involved in positive transcriptional regulation. SLIK is proposed to have partly overlapping functions with SAGA. It preferentially acetylates methylated histone H3. ADA preferentially acetylates nucleosomal histones H3 (to form H3K14ac and H3K18ac) and H2B (By similarity). Required for full activation of chromatin alteration and meiotic recombination at meiotic recombination hot spot ade6-M26. Also required for the regulation of transcription and chromatin structure around ade6-M26 in response to osmotic stress. Needed for hyperacetylation of histone H3 around ade6-M26..
Protein Sequence	MPPQKYHCNVCAQDITRSIHIRCVECVDFDLCIPCFTSGASLGTHHPSHPYRIIETNSYPIFDENWGADEELLLIDACETLGLGNWADIADYVGNARTKEECRDHYLKTYIESDCYPLASVELPGPVDRIAFAARKRARIEAFQPPPIIPQKPLASTPQCHEIQGYMPGRLEFDQEYMNEAELPIKDMNFDDDLHESAKHEMQLKLTMLNIYNSRLTRRAVRKQTIFNHNLLDYRRLQANEKRMSKEERNLLNKTKAFARLLTGPDYQKFVNSYHEQITLKKQISDLQEWRQMGLTTLEQGHKYERDKTQKFLLSKASASYDKQLRHVKSFNQTTSAPFQVRDIQKIVPRKPATPTMFSASADRQLLSEDEQALCSKLQIFPKPFLALKFALISASLTSKKPFQKTDAVNLFKHLDANKVEQVYDFFHNARWIGAPT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
330	Phosphorylation	KQLRHVKSFNQTTSA HHHHCHHHHCCCCCC	28.48	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ADA2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ADA2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ADA2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ADA2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ADA2_SCHPO

Related Literatures of Post-Translational Modification