| UniProt ID | YJM7_SCHPO | |
|---|---|---|
| UniProt AC | O59760 | |
| Protein Name | Putative uncharacterized hydrolase C1020.07 | |
| Gene Name | SPCC1020.07 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 236 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | ||
| Protein Sequence | MIPEACLFDMDGLLVDTESIYTKSTNIILKRYNKGPFSMEVKAKMMGRTSKEASRIFLDWSGIDLTCEEYIALQRETQAELWRHTKPLPGVMNLLSKLKSLNIPIALATSSDTHNFEKKSAHLSHLFDHFDGNIITGDDPRLPVGRGKPHPDIWFIALKMINDKRKAQGQAEILPENCLVFEDSITGVQSGRAAGMKVVWVPDVNILPFFSLSPEQAADKHITKVLSLENFDVTKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YJM7_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJM7_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJM7_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJM7_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PLR2_SCHPO | SPCC1281.04 | genetic | 22681890 | |
| YN8E_SCHPO | SPBP35G2.14 | genetic | 22681890 | |
| GET1_SCHPO | get1 | genetic | 22681890 | |
| TMA20_SCHPO | tma20 | genetic | 22681890 | |
| BCA1_SCHPO | eca39 | genetic | 22681890 | |
| YBPC_SCHPO | SPBC16H5.12c | genetic | 22681890 | |
| ASH2_SCHPO | ash2 | genetic | 22681890 | |
| YQ56_SCHPO | SPCC162.06c | genetic | 22681890 | |
| IF5A2_SCHPO | tif512 | genetic | 22681890 | |
| YGK4_SCHPO | SPBC725.04 | genetic | 22681890 | |
| FKBPH_SCHPO | SPAC27F1.06c | genetic | 22681890 | |
| YNW5_SCHPO | yar1 | genetic | 22681890 | |
| ATP5E_SCHPO | atp15 | genetic | 22681890 | |
| YAM5_SCHPO | mso1 | genetic | 22681890 | |
| YCB5_SCHPO | SPCC61.05 | genetic | 22681890 | |
| YI4C_SCHPO | SPBC1348.12 | genetic | 22681890 | |
| RF1M_SCHPO | mrf1 | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...