UniProt ID | YJM7_SCHPO | |
---|---|---|
UniProt AC | O59760 | |
Protein Name | Putative uncharacterized hydrolase C1020.07 | |
Gene Name | SPCC1020.07 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 236 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MIPEACLFDMDGLLVDTESIYTKSTNIILKRYNKGPFSMEVKAKMMGRTSKEASRIFLDWSGIDLTCEEYIALQRETQAELWRHTKPLPGVMNLLSKLKSLNIPIALATSSDTHNFEKKSAHLSHLFDHFDGNIITGDDPRLPVGRGKPHPDIWFIALKMINDKRKAQGQAEILPENCLVFEDSITGVQSGRAAGMKVVWVPDVNILPFFSLSPEQAADKHITKVLSLENFDVTKV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YJM7_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJM7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJM7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJM7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PLR2_SCHPO | SPCC1281.04 | genetic | 22681890 | |
YN8E_SCHPO | SPBP35G2.14 | genetic | 22681890 | |
GET1_SCHPO | get1 | genetic | 22681890 | |
TMA20_SCHPO | tma20 | genetic | 22681890 | |
BCA1_SCHPO | eca39 | genetic | 22681890 | |
YBPC_SCHPO | SPBC16H5.12c | genetic | 22681890 | |
ASH2_SCHPO | ash2 | genetic | 22681890 | |
YQ56_SCHPO | SPCC162.06c | genetic | 22681890 | |
IF5A2_SCHPO | tif512 | genetic | 22681890 | |
YGK4_SCHPO | SPBC725.04 | genetic | 22681890 | |
FKBPH_SCHPO | SPAC27F1.06c | genetic | 22681890 | |
YNW5_SCHPO | yar1 | genetic | 22681890 | |
ATP5E_SCHPO | atp15 | genetic | 22681890 | |
YAM5_SCHPO | mso1 | genetic | 22681890 | |
YCB5_SCHPO | SPCC61.05 | genetic | 22681890 | |
YI4C_SCHPO | SPBC1348.12 | genetic | 22681890 | |
RF1M_SCHPO | mrf1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...