UniProt ID | IF5A2_SCHPO | |
---|---|---|
UniProt AC | Q9UST4 | |
Protein Name | Eukaryotic translation initiation factor 5A-2 | |
Gene Name | tif51b | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 169 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis (By similarity).. | |
Protein Sequence | MGMFIQKEHKPTMAEEEHVDFEGGEAGASLTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHIVALDIFNGRKYEDMSPSTHNMDVPVVKRDEYQLVNIDDGYLNLMTTDGTTKDDVRLPEGELGNEIEEGFEEGKDLIITVVSAMGEEIALACRDAPSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | PCKIVDMSTSKTGKH ECEEEECCCCCCCCC | 25.68 | 27738172 | |
64 | Hypusine | MSTSKTGKHGHAKVH CCCCCCCCCCCEEEE | 52.20 | - | |
64 | Other | MSTSKTGKHGHAKVH CCCCCCCCCCCEEEE | 52.20 | - | |
87 | Phosphorylation | GRKYEDMSPSTHNMD CCCCCCCCCCCCCCC | 28.20 | 28889911 | |
89 | Phosphorylation | KYEDMSPSTHNMDVP CCCCCCCCCCCCCCC | 34.68 | 28889911 | |
90 | Phosphorylation | YEDMSPSTHNMDVPV CCCCCCCCCCCCCCC | 22.21 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IF5A2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF5A2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF5A2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of IF5A2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...