YOHB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YOHB_SCHPO
• UniProt AC: O14364
• Protein Name: Uncharacterized protein C13E7.11
• Gene Name: SPBC13E7.11, SPBC30D10.19c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 298
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MNRLNFQSLLWKFGQKRFYYRPWIRIENIKPTPLWKPITFAVGVGSATFYTANYLDKRRKNYPKSSYGFPIPQTSSRSLVLSIIGINVGVFALWRAPRFSHLNRFLQKYAVMNPIFINMPSMIVSAFSHQSGWHLLFNMVAFYSFAPAIVDVFGNNQFVAFYISSILFSNVASLLHHRLRFGTKVTPGSLGASGAIYAIAAATSYFFPNASVSIIFLPFIPIKIGVALLGLMAFDAWGLISRGFSSFANFTLIDHAAHLGGGIFGWLYAKYGYSTYNRSTRPRPPSLSKPFFSRSVSF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
295	Phosphorylation	SKPFFSRSVSF---- CCCCCCCCCCC----	22.40	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YOHB_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YOHB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YOHB_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YOHB_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.