END3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: END3_SCHPO
• UniProt AC: Q9USZ7
• Protein Name: Actin cytoskeleton-regulatory complex protein end3
• Gene Name: end3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 375
• Subcellular Localization: Cell membrane; Peripheral membrane protein; Cytoplasmic side. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, actin patch. Cytoplasmic and cortical actin patches..
• Protein Description: Component of the PAN1 actin cytoskeleton-regulatory complex required for the internalization of endosomes during actin-coupled endocytosis. The complex links the site of endocytosis to the cell membrane-associated actin cytoskeleton. Mediates uptake of external molecules and vacuolar degradation of plasma membrane proteins. Plays a role in the proper organization of the cell membrane-associated actin cytoskeleton and promotes its destabilization (By similarity)..
• Protein Sequence: MDPQEKNKYWEIFRGLNPENGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAMKITFDLINGVYKTVPDRVPEALVSTSKKHLVAARDALRGNDDIALLHKVPSLDTDPEDAVLKDGFDWYISPSDKIRYSDIYSLHCNKHGEVSFNGLAPVFTPFGVPNSQIQKAWKLVNPQGTETIQKDQCLVFLHILTQRSNGFRIPNDVPYSLKASFKRGNIDYNLDSYNSTNNYYSSPTMAPSTGGAKPKSDLDAPRDVRDSDWELISLRNELSKLDEKILSLQRETDDVNIAQNKSKLIQRDLQKVLDYKLGILQSLKNDGPNGPSASAIDNDLKMLEQQLNVLGRHLEGRKSQVAKLEERLRSLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Phosphorylation	KAAGVLRSSKLSSDK HHHHHHHCCCCCHHH	27.88	21712547
38	Phosphorylation	VLRSSKLSSDKLEKI HHHCCCCCHHHHHHH	39.98	21712547
39	Phosphorylation	LRSSKLSSDKLEKIW HHCCCCCHHHHHHHH	49.56	21712547
117	Phosphorylation	ALLHKVPSLDTDPED EEEECCCCCCCCHHH	41.69	28889911
120	Phosphorylation	HKVPSLDTDPEDAVL ECCCCCCCCHHHCHH	59.76	21712547
242	Phosphorylation	SYNSTNNYYSSPTMA CCCCCCCCCCCCCCC	13.54	29996109
243	Phosphorylation	YNSTNNYYSSPTMAP CCCCCCCCCCCCCCC	12.56	29996109
244	Phosphorylation	NSTNNYYSSPTMAPS CCCCCCCCCCCCCCC	21.34	24763107
245	Phosphorylation	STNNYYSSPTMAPST CCCCCCCCCCCCCCC	14.31	21712547
247	Phosphorylation	NNYYSSPTMAPSTGG CCCCCCCCCCCCCCC	28.10	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of END3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of END3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of END3_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of END3_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.