dbPTM

EMP24_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EMP24_SCHPO
UniProt AC	Q9P7I9
Protein Name	Endosomal protein P24B
Gene Name	emp24
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	199
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type I membrane protein . Golgi apparatus membrane Single-pass type I membrane protein. Recycles between endoplasmic reticulum and Golgi..
Protein Description	Constituent of COPII-coated endoplasmic reticulum-derived transport vesicles. Required for efficient transport of a subset of secretory proteins to the Golgi (By similarity)..
Protein Sequence	MAFFNVFKAVLCAYFISVVFGHGITLKPHQRECFYENLRNNDQMSVTYQTNVGGDQLVSMSIYNPAGQIMHQEVPNSMAQYSFTVKNPGKYMYCFYNDALDGESKEVLFNVHGVIYISDEDLDANNPLLGKVRQLHDTISKVKHEQEYFVARERIHRNTAESTNDRVKWWSILQTVILVSVCVFQIFYLKRLFEVKRVV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of EMP24_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EMP24_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EMP24_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EMP24_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of EMP24_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EMP24_SCHPO

Related Literatures of Post-Translational Modification