UniProt ID | SPO7_SCHPO | |
---|---|---|
UniProt AC | Q9USQ0 | |
Protein Name | Sporulation-specific protein spo7 | |
Gene Name | spo7 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 180 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Nucleus membrane Multi-pass membrane protein. |
|
Protein Description | Probable regulatory component of the nem1-spo7 complex which acts as a phosphatase and may be required for proper nuclear membrane morphology.. | |
Protein Sequence | MSSYVPNTLSVYHNLLILEASFRKTYLQLQVRRQKYMAFYVSLLVWNFYFGYRVFYRISKYSLIDLTYKLCLLCGIVTLLLFYFSGLYRTTIVYPSRYVQQVNKAMRFFNIRLVITPVPWFQVRKPLDCGVHLILSSKRFDILVIEGWEAFRSSYFASIHRKNNSIQSNESSESPSSKQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | RQKYMAFYVSLLVWN HHHHHHHHHHHHHHH | 4.60 | 25720772 | |
42 | Phosphorylation | KYMAFYVSLLVWNFY HHHHHHHHHHHHHHH | 12.47 | 25720772 | |
52 | Phosphorylation | VWNFYFGYRVFYRIS HHHHHHHHHHHHHHH | 8.16 | 25720772 | |
163 | N-linked_Glycosylation | FASIHRKNNSIQSNE HHHHHHHCCCCCCCC | 47.65 | - | |
165 | Phosphorylation | SIHRKNNSIQSNESS HHHHHCCCCCCCCCC | 31.25 | 21712547 | |
169 | N-linked_Glycosylation | KNNSIQSNESSESPS HCCCCCCCCCCCCCC | 36.47 | - | |
174 | Phosphorylation | QSNESSESPSSKQN- CCCCCCCCCCCCCC- | 31.84 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPO7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPO7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPO7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPO7_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...