RS12B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS12B_SCHPO
• UniProt AC: O74322
• Protein Name: 40S ribosomal protein S12-B
• Gene Name: rps1202
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 148
• Protein Sequence: MSTEGDHVPQAEEVIETVEVVEEETGSSPLSVEDSLKEVLKRALVHDGLARGIREASKALDRRQAHLCVLCESCDQEAYVKLVEALCAESQTPLVKVADPKILGEWAGLCVLDRDGNARKVVGCSCVAVTDYGEDSVALQTLLSSFAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSTEGDHVP ------CCCCCCCCC	34.86	21712547
3	Phosphorylation	-----MSTEGDHVPQ -----CCCCCCCCCC	42.56	29996109
17	Phosphorylation	QAEEVIETVEVVEEE CHHHHHHEEEEEECH	15.73	29996109
25	Phosphorylation	VEVVEEETGSSPLSV EEEEECHHCCCCCCH	45.72	21712547
31	Phosphorylation	ETGSSPLSVEDSLKE HHCCCCCCHHHHHHH	27.18	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS12B_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS12B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS12B_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RS12B_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.