| UniProt ID | PPA2_SCHPO | |
|---|---|---|
| UniProt AC | Q01682 | |
| Protein Name | Thiamine-repressible acid phosphatase pho4 | |
| Gene Name | pho4 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 463 | |
| Subcellular Localization | Secreted, cell wall. | |
| Protein Description | May dephosphorylate thiamine phosphates.. | |
| Protein Sequence | MKLSGISLWLLAASIVHAGKSQFEAFENEFYFKDHLGTISVYHEPYFNGPTTSFPESCAIKQVHLLQRHGSRNPTGDDTATDVSSAQYIDIFQNKLLNGSIPVNFSYPENPLYFVKHWTPVIKAENADQLSSSGRIELFDLGRQVFERYYELFDTDVYDINTAAQERVVDSAEWFSYGMFGDDMQNKTNFIVLPEDDSAGANSLAMYYSCPVYEDNNIDENTTEAAHTSWRNVFLKPIANRLNKYFDSGYNLTVSDVRSLYYICVYEIALRDNSDFCSLFTPSEFLNFEYDSDLDYAYWGGPASEWASTLGGAYVNNLANNLRKGVNNASDRKVFLAFTHDSQIIPVEAALGFFPDITPEHPLPTDKNIFTYSLKTSSFVPFAGNLITELFLCSDNKYYVRHLVNQQVYPLTDCGYGPSGASDGLCELSAYLNSSVRVNSTSNGIANFNSQCQAHSTNVTVYY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 98 | N-linked_Glycosylation | IFQNKLLNGSIPVNF HHCCCCCCCCCCCCC | 53.23 | - | |
| 104 | N-linked_Glycosylation | LNGSIPVNFSYPENP CCCCCCCCCCCCCCC | 18.13 | - | |
| 186 | N-linked_Glycosylation | MFGDDMQNKTNFIVL CCCCCCCCCCCEEEE | 46.62 | - | |
| 221 | N-linked_Glycosylation | EDNNIDENTTEAAHT CCCCCCCCCHHHHHH | 48.86 | - | |
| 251 | N-linked_Glycosylation | KYFDSGYNLTVSDVR HHHHCCCCEEHHHHH | 32.53 | - | |
| 328 | N-linked_Glycosylation | NLRKGVNNASDRKVF HHHHCCCCCCCCCEE | 38.11 | - | |
| 433 | N-linked_Glycosylation | CELSAYLNSSVRVNS HHHHHHHCCCCEECC | 21.40 | - | |
| 439 | N-linked_Glycosylation | LNSSVRVNSTSNGIA HCCCCEECCCCCCEE | 29.07 | - | |
| 458 | N-linked_Glycosylation | QCQAHSTNVTVYY-- HCCCCCCCEEEEC-- | 30.40 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPA2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPA2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPA2_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PFL4_SCHPO | pfl4 | genetic | 22681890 | |
| NEM1_SCHPO | nem1 | genetic | 22681890 | |
| AROG_SCHPO | SPAP8A3.07c | genetic | 22681890 | |
| ABC2_SCHPO | abc2 | genetic | 22681890 | |
| PDS5_SCHPO | pds5 | genetic | 22681890 | |
| PRZ1_SCHPO | prz1 | genetic | 22681890 | |
| YETC_SCHPO | SPAC8C9.12c | genetic | 22681890 | |
| YQK8_SCHPO | SPCC1494.08c | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
