dbPTM

REC27_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	REC27_SCHPO
UniProt AC	Q9USR4
Protein Name	Meiotic recombination protein rec27
Gene Name	rec27
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	134
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Required for correct meiotic chromosome segregation and recombination..
Protein Sequence	MATHSCKGFMNVNLKKKQLQITSSEIIEHVLEELNLKNIERRVKKYDQIESEYKTNIENEKKAFIKDVSQVQQKIKEFEIQKANQIKQLNEEKLSIEARKQQLEIEIRNQLLQYAEKLRIVVKTPMNQPTNTEV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of REC27_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of REC27_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of REC27_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of REC27_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of REC27_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of REC27_SCHPO

Related Literatures of Post-Translational Modification