UniProt ID | HEM3_SCHPO | |
---|---|---|
UniProt AC | Q09899 | |
Protein Name | Porphobilinogen deaminase | |
Gene Name | hem3 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 336 | |
Subcellular Localization | ||
Protein Description | Tetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps.. | |
Protein Sequence | MPSCTSFPIGTRKSKLAVIQSEIIREELEKHYPHLEFPIISRDTIGDEILSKALFEFKRQLAKSLWTRELEALLVTNQCRILVHSLKDLPSEMPDGMVIACIPKRSCPLDAIVFKAGSHYKTVADLPPGSVVGTSSIRRRALLARNFPHLRFVDIRGNVGTRLAKLDAPDSQFDCLVLAAAGLFRLGLKDRIAQMLTAPFVYYAVGQGALAVEVRADDKEMIEMLKPLQHQETLYACLAERALMKRLQGGCAIPIGVQTDVLAISNSSYRISLLGTVLSADGLRAAFGNAEAVVSSEEEAEELGITVALALLKNGAGPILEEHQRSSDSEESLKNY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
251 | S-(dipyrrolylmethanemethyl)cysteine | MKRLQGGCAIPIGVQ HHHHCCCCCCCCCCC | 3.87 | - | |
251 | Pyrrolylation | MKRLQGGCAIPIGVQ HHHHCCCCCCCCCCC | 3.87 | - | |
326 | Phosphorylation | ILEEHQRSSDSEESL HHHHHHHCCCCHHHH | 31.74 | 28889911 | |
327 | Phosphorylation | LEEHQRSSDSEESLK HHHHHHCCCCHHHHH | 47.55 | 28889911 | |
329 | Phosphorylation | EHQRSSDSEESLKNY HHHHCCCCHHHHHCC | 45.25 | 28889911 | |
332 | Phosphorylation | RSSDSEESLKNY--- HCCCCHHHHHCC--- | 40.36 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HEM3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HEM3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HEM3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HEM3_SCHPO | hem3 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...