dbPTM

HIS1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HIS1_SCHPO
UniProt AC	P40373
Protein Name	ATP phosphoribosyltransferase
Gene Name	his1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	310
Subcellular Localization	Cytoplasm.
Protein Description	Catalyzes the condensation of ATP and 5-phosphoribose 1-diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate of histidine biosynthesis seems to be controlled primarily by regulation of HisG enzymatic activity (By similarity)..
Protein Sequence	MDLVNHLEDRLLFAVPKKGRLYESCVNVLKGSDIKFRRNPRLDIALVQNLPIALVFLPAADIPRFVGTGRVHLGITGQDQIAEARLRIGDKLKIEELVDLQFGGCKLQVQVPESGDITSVDQLVGRRIVTSFEYLVAEYFDKVEKKAKSEGKVDSGIKTEISFVSGSVEASCALGIADAVVDLVESGETMRASGLKPIETVMSTSAVLVRSSNCSSELEPLLQTIITRIRGYIIAQQYVLVNYNVNREHLPVVLKITPGKRAPTITTLDEPGWVAVSSMVVKKEVAQVMDKLSQNHAHDILVLSIDNSRP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
211	Phosphorylation	TSAVLVRSSNCSSEL CCEEEEECCCCCHHH	20.58	25720772
212	Phosphorylation	SAVLVRSSNCSSELE CEEEEECCCCCHHHH	31.15	25720772
215	Phosphorylation	LVRSSNCSSELEPLL EEECCCCCHHHHHHH	30.97	25720772
216	Phosphorylation	VRSSNCSSELEPLLQ EECCCCCHHHHHHHH	48.69	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HIS1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HIS1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HIS1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HIS1_SCHPO	his1	physical	26771498
YF75_SCHPO	spa2	physical	26771498
IMA2_SCHPO	imp1	physical	26771498
TEA4_SCHPO	tea4	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HIS1_SCHPO

Related Literatures of Post-Translational Modification