ATG8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATG8_SCHPO
• UniProt AC: O94272
• Protein Name: Autophagy-related protein 8
• Gene Name: atg8
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 121
• Subcellular Localization: Cytoplasmic vesicle, autophagosome membrane ; Lipid-anchor . Vacuole membrane ; Lipid-anchor .
• Protein Description: Ubiquitin-like modifier involved in autophagosomes formation. With atg4, mediates the delivery of the autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Contributes to the maintenance of cell viability under conditions of nitrogen-depletion. Plays a role in meiosis and sporulation and contributes to oxidative stress resistance. [PubMed: 17295836]
• Protein Sequence: MRSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQFVYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFGTVFPF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
116	Phosphatidylethanolamine amidation	YSGENTFGTVFPF-- ECCCCCEEEEECC--	20.94	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATG8_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATG8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATG8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VPS1_SCHPO	vps1	genetic	20070859
ATG3_SCHPO	atg3	physical	23950735
ATG4_SCHPO	atg4	physical	23950735
ATG5_SCHPO	atg5	physical	23950735
ATG7_SCHPO	atg7	physical	23950735
ATG10_SCHPO	atg10	physical	23950735
ATG12_SCHPO	atg12	physical	23950735
ATG16_SCHPO	atg16	physical	23950735
ATG18_SCHPO	atg1801	physical	23950735
AMS2_SCHPO	ams2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.