ATG3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATG3_SCHPO
• UniProt AC: O43035
• Protein Name: Autophagy-related protein 3
• Gene Name: atg3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 275
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8. The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8 from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8. The formation of the atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Plays a role in meiosis and sporulation..
• Protein Sequence: MAQRLTSAFLNWREHITPASKTSDFENTGMISPEEFVLAGDYLVSKFPTWSWECGDRIRGFLPKDKQYLVTRHVFCVQRNINIGVNEEWVDIETDDTRNKDDDQDDDAISSIHSDTSDIASAERLKGQSKELSDSGPLPLKDEEDDDQMVSPVIKEDEGRYYDLYIVYDKYYRTPRLFLRGWNAGGQLLTMKDIYEDVSGEHAGKTVTMEPFPHYHSHNTMASVHPCKHASVLLKLIKQHRERNDPIRVDQYMVLFLKFVSTMLPYFEIDYTIQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
110	Phosphorylation	DQDDDAISSIHSDTS CCCHHHHHHHCCCHH	25.59	24763107
111	Phosphorylation	QDDDAISSIHSDTSD CCHHHHHHHCCCHHH	20.43	24763107
114	Phosphorylation	DAISSIHSDTSDIAS HHHHHHCCCHHHHHH	40.70	28889911
116	Phosphorylation	ISSIHSDTSDIASAE HHHHCCCHHHHHHHH	31.17	21712547
117	Phosphorylation	SSIHSDTSDIASAER HHHCCCHHHHHHHHH	31.82	28889911
121	Phosphorylation	SDTSDIASAERLKGQ CCHHHHHHHHHHCCC	30.88	24763107
133	Phosphorylation	KGQSKELSDSGPLPL CCCCCCCCCCCCCCC	30.71	28889911
151	Phosphorylation	EDDDQMVSPVIKEDE CCCCCEECCEEECCC	14.22	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATG3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATG3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATG3_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of ATG3_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.