dbPTM

ATG12_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATG12_SCHPO
UniProt AC	Q9US24
Protein Name	Ubiquitin-like protein ATG12
Gene Name	atg12
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	132
Subcellular Localization	Cytoplasm . Nucleus . Preautophagosomal structure membrane Peripheral membrane protein.
Protein Description	Ubiquitin-like protein involved in cytoplasm to vacuole transport (Cvt), autophagy vesicles formation, mitophagy, and nucleophagy. Conjugation with atg5 through a ubiquitin-like conjugating system involving also atg7 as an E1-like activating enzyme and atg10 as an E2-like conjugating enzyme, is essential for its function. The atg12-atg5 conjugate functions as an E3-like enzyme which is required for lipidation of atg8 and atg8 association to the vesicle membranes (By similarity). Plays a role in meiosis and sporulation..
Protein Sequence	MTGLVDQQELEKRLATEEDSQNEDIENQLPSIETIINTYREKENRRVNLRFKAIGRTPLLRKTVFSINASQRFEKVTRFLKKELGLPMNSSLVLYVNSSFAPSPDEIVGNLYDNFAIDSHLLINYCINVAFG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
16	Phosphorylation	ELEKRLATEEDSQNE HHHHHHCCCHHHCCH	44.49	21712547
20	Phosphorylation	RLATEEDSQNEDIEN HHCCCHHHCCHHHHH	37.88	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATG12_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATG12_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATG12_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ATG5_SCHPO	atg5	physical	23950735

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATG12_SCHPO

Related Literatures of Post-Translational Modification