UniProt ID | PCS1_SCHPO | |
---|---|---|
UniProt AC | O13684 | |
Protein Name | Monopolin complex subunit pcs1 | |
Gene Name | pcs1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 261 | |
Subcellular Localization | Nucleus, nucleolus . Chromosome, centromere . Nucleolar during G2 (PubMed:12689592). Localizes to the centromeres throughout most stages of vegetative growth and meiotic development apart from the horse tail stage of prophase I (PubMed:12689592). Loc | |
Protein Description | The monopolin-like pcs1/mde4 complex is essential for accurate chromosome segregation during mitosis and meiosis II. May clamp together microtubule binding sites on the same kinetochore, preventing merotelic attachment of microtubules. In contrast to its S.cerevisiae ortholog CSM1, is not required ofr mono-orientation during meiosis I.. | |
Protein Sequence | MRKNNMQTSKDSELKEQAKGKSSKLIHKLPKQRTRISQGQMHSTQDFVNNEDQDAYSVRENENELHINNSGMSELNKKLQLPNVELSTLSHTQEQEFNELNKLIRKINELQEFYLLEDLAKPVTNAGADADDTIVKDLKKELENEKKANHSLKNELLKTREQIKNYSKINILIKELFGLEVADCIEDEDGYRFNCKNTGRRGTLEYQLLLDDQNFTFTPRLNVQTDEELMKHLPDYLLEEIIFTKEQGKLFSARLMKALQD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PCS1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCS1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCS1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MDE4_SCHPO | mde4 | physical | 17627824 | |
HMT1_SCHPO | hmt1 | genetic | 20221439 | |
MDE4_SCHPO | mde4 | physical | 20723757 | |
PCS1_SCHPO | csm1 | physical | 20723757 | |
SMC4_SCHPO | cut3 | physical | 21633354 | |
CND2_SCHPO | cnd2 | physical | 21633354 | |
CND1_SCHPO | cnd1 | physical | 21633354 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...