dbPTM

PCS1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PCS1_SCHPO
UniProt AC	O13684
Protein Name	Monopolin complex subunit pcs1
Gene Name	pcs1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	261
Subcellular Localization	Nucleus, nucleolus . Chromosome, centromere . Nucleolar during G2 (PubMed:12689592). Localizes to the centromeres throughout most stages of vegetative growth and meiotic development apart from the horse tail stage of prophase I (PubMed:12689592). Loc
Protein Description	The monopolin-like pcs1/mde4 complex is essential for accurate chromosome segregation during mitosis and meiosis II. May clamp together microtubule binding sites on the same kinetochore, preventing merotelic attachment of microtubules. In contrast to its S.cerevisiae ortholog CSM1, is not required ofr mono-orientation during meiosis I..
Protein Sequence	MRKNNMQTSKDSELKEQAKGKSSKLIHKLPKQRTRISQGQMHSTQDFVNNEDQDAYSVRENENELHINNSGMSELNKKLQLPNVELSTLSHTQEQEFNELNKLIRKINELQEFYLLEDLAKPVTNAGADADDTIVKDLKKELENEKKANHSLKNELLKTREQIKNYSKINILIKELFGLEVADCIEDEDGYRFNCKNTGRRGTLEYQLLLDDQNFTFTPRLNVQTDEELMKHLPDYLLEEIIFTKEQGKLFSARLMKALQD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
34	Phosphorylation	HKLPKQRTRISQGQM HHCCHHCCCCCCCCC	29.84	29996109
37	Phosphorylation	PKQRTRISQGQMHST CHHCCCCCCCCCCCC	25.60	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PCS1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PCS1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PCS1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MDE4_SCHPO	mde4	physical	17627824
HMT1_SCHPO	hmt1	genetic	20221439
MDE4_SCHPO	mde4	physical	20723757
PCS1_SCHPO	csm1	physical	20723757
SMC4_SCHPO	cut3	physical	21633354
CND2_SCHPO	cnd2	physical	21633354
CND1_SCHPO	cnd1	physical	21633354

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PCS1_SCHPO

Related Literatures of Post-Translational Modification