YK62_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YK62_SCHPO
• UniProt AC: Q9US15
• Protein Name: UPF0653 protein C607.02c
• Gene Name: SPAC607.02c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 231
• Subcellular Localization: Nucleus, nucleolus .
• Protein Sequence: MPTKTKKRSVLEAERKKIGLDHAPKEDESVDDNFPKQFKRLLQQKEYHESKKKEIKKGNLKNKKKKDYGKIQRLPGERLSEFSQRVNKAIPVSFKSGPSKIDEFTDKKEKKKIAKRKEKRERDWNEIEENFEDKTWEADTTGQFIQIESRKKRKNSPDPWANLQTKPSFGETVQAPPELPELKIKETKYLENVPKVNNMGQTESMARRQALGKQRLELIEKYRELMKTKRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	Phosphorylation	HAPKEDESVDDNFPK CCCCCCCCCCCCHHH	43.07	24763107
96	Phosphorylation	AIPVSFKSGPSKIDE HCCCCCCCCCCCHHH	54.66	25720772
156	Phosphorylation	SRKKRKNSPDPWANL CCCCCCCCCCCCCCC	33.44	24763107
165	Phosphorylation	DPWANLQTKPSFGET CCCCCCCCCCCCCCC	48.35	21712547
172	Phosphorylation	TKPSFGETVQAPPEL CCCCCCCCCCCCCCC	20.49	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YK62_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YK62_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YK62_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YK62_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.