ACBP_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACBP_SCHPO
• UniProt AC: Q9Y7Z3
• Protein Name: Putative acyl-CoA-binding protein
• Gene Name: SPBC1539.06
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 87
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters..
• Protein Sequence: MSSTFEQAAADVKELKETPNSDELLKLYALFKQATVGDNNTEKPGLLDLKGKFKWNAWEELKGKSKEDAASEYISFVDELKTKYGMK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
65	Phosphorylation	WEELKGKSKEDAASE HHHHCCCCHHHHHHH	50.36	25720772
71	Phosphorylation	KSKEDAASEYISFVD CCHHHHHHHHHHHHH	32.43	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACBP_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACBP_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACBP_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of ACBP_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.