RL17A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL17A_SCHPO
• UniProt AC: O14339
• Protein Name: 60S ribosomal protein L17-A
• Gene Name: rpl1701
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 187
• Protein Sequence: MVRYSASPALETKCAKARGAYLRTHFKNSREVAFTINGMSLKKAFIFLDNVKEHKQAVPFRRFNGGVGRTAQGKEFGVTQARWPVKSVKFFYDLLKNAEANAEAKGLDMDKLIIKHVQVNAAPKQRRRTYRAHGRVTAYLSSPSHIEIIVAEEEEAVPKANDTVSRVSLKQGAKARNLAARKAITAA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MVRYSASPALET ---CCCCCCCHHHHH	16.23	24763107
7	Phosphorylation	-MVRYSASPALETKC -CCCCCCCHHHHHHH	12.55	28889911
12	Phosphorylation	SASPALETKCAKARG CCCHHHHHHHHHHHC	32.07	28889911
40	Phosphorylation	AFTINGMSLKKAFIF EEEECCEECCEEEEE	38.13	21712547
70	Phosphorylation	FNGGVGRTAQGKEFG CCCCCCCCCCCCCCC	19.87	25720772
165	Phosphorylation	PKANDTVSRVSLKQG CCCCCCCCHHHHHHH	29.11	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL17A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL17A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL17A_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RL17A_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.