dbPTM

MRS2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MRS2_SCHPO
UniProt AC	P87149
Protein Name	Mitochondrial inner membrane magnesium transporter mrs2
Gene Name	mrs2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	422
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	High-conductance magnesium-selective channel that mediates the influx of magnesium into the mitochondrial matrix. Essential for the splicing of mRNA group II introns in mitochondria by affecting mitochondrial magnesium concentrations, which are critical for group II intron splicing. It also suppresses a variety of mitochondrial intron mutations and its absence may disturb the assembly of mitochondrial membrane complexes..
Protein Sequence	MVLIVGFNLRTSIASFSPICRSLFLFPKYRSRIIRPVVLLEKPFDKHFYATDSNPLITGFPETSKNCPPSVAATKNRLLMNCTEFDDHGNVRVISGDFKKMDLCKQNGLLPRDLRKLNTSINSIVPVILVREGSILINLLHIRALIKANSVLLFDVYGSQHSHSQSQFIYELEGRLKQKSSDFGWLPYEMRALETILVSVVNTLDSELHVLHNLVSDLLADFELDINQERLRTLLIFSKRLSGFLKKATLIRDVLDELLEQDQDLAGMYLTERLKTGKPRDLDKHDEVELLLETYCKQVDEIVQQTDNLVGNIRSTEEICNIMLDANRNSLMLLGLKLSAMTLGLGFGAVVASLYGMNLQNGLENHPYAFYITTGSIFAFAAFLSSLGILKIRRLKRIQMALYHRCNLPISLDPRSLRPPYL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MRS2_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MRS2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MRS2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MRS2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MRS2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MRS2_SCHPO

Related Literatures of Post-Translational Modification