dbPTM

RLA3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RLA3_SCHPO
UniProt AC	P17477
Protein Name	60S acidic ribosomal protein P1-alpha 3
Gene Name	rpp102
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	110
Subcellular Localization
Protein Description	Plays an important role in the elongation step of protein synthesis..
Protein Sequence	MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLLNIGSAAAAPAAGGAGAPAAAAGGEAAAEEQKEEAKEEEESDEDMGFGLFD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
64	Phosphorylation	ELLLNIGSAAAAPAA HHHHHHHHHHHCCCC	15.78	27738172
100	Phosphorylation	EAKEEEESDEDMGFG HHHHHHHCCCCCCCC	49.97	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RLA3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RLA3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RLA3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RLA0_SCHPO	rpp0	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RLA3_SCHPO

Related Literatures of Post-Translational Modification