RLA0_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RLA0_SCHPO
• UniProt AC: O74864
• Protein Name: 60S acidic ribosomal protein P0
• Gene Name: rpp0
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 312
• Protein Description: Ribosomal protein P0 is the functional equivalent of E.coli protein L10..
• Protein Sequence: MAISKESKAQYFEKLRSLFEKYNSLFVVNIDNVSSQQMHTVRKQLRGTAELIMGKNTMIRRAMRGIINDMPELERLLPVVRGNVGFVFTNADLKEVRETIIANVIAAPARPNAIAPLDVFVPAGNTGMEPGKTSFFQALGIPTKITRGTIEITSDVHLVSKDAKVGPSEATLLNMLNISPFTYGMDVLTIYDQGNVFSPEILDVSEEDLIGHLLSAASIITAISLGANYPTILSVMHSVVNAYKNLVAVSLATEYTFEGTEQTKAFLADPSAFVVAAAPAAAAGGEAEAPAAEAAAEEEEESDEDMGFGLFD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
133	Phosphorylation	TGMEPGKTSFFQALG CCCCCCCCCHHHHCC	36.36	25720772
134	Phosphorylation	GMEPGKTSFFQALGI CCCCCCCCHHHHCCC	27.78	25720772
271	Phosphorylation	KAFLADPSAFVVAAA HHHHCCHHHHHEEEH	34.58	21712547
302	Phosphorylation	AAEEEEESDEDMGFG HHHHHHHCCCCCCCC	49.97	19547744

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
302	S	Phosphorylation	Kinase	CK1	-	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RLA0_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RLA0_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of RLA0_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.